(data stored in ACNUC7421 zone)

EMBL: CP001389.PE415

CP001389.PE415       Location/Qualifiers
FT   CDS             474342..475160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04230"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24219"
FT                   /db_xref="GOA:C3MGV4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV4"
FT                   /protein_id="ACP24219.1"
FT                   /translation="MSEAALQTASSRNEDLKLILAAAVAAGDTALGYFRKSVDVRWKNE
FT                   GRSPVSEADLAANDILKTRLLGARPDYGWLSEETDDDATRLARDTVFVVDPIDGTRAFI
FT                   SGKDLWCVSVAVVHQGRPTAGVLYAPALGEIFEATLDGEARKNGAAIAVRDPVPDERLQ
FT                   VAMAEDLVGKLAVPYRDRLARVPHVPSLAYRLAMIADGRIDGTIVKKNAHDWDLAAADL
FT                   ILARAGGALRGLDGMPLSYNRPIVSHGVLGAGSGLALPSLLAASRPFDAH"
     MSEAALQTAS SRNEDLKLIL AAAVAAGDTA LGYFRKSVDV RWKNEGRSPV SEADLAANDI        60
     LKTRLLGARP DYGWLSEETD DDATRLARDT VFVVDPIDGT RAFISGKDLW CVSVAVVHQG       120
     RPTAGVLYAP ALGEIFEATL DGEARKNGAA IAVRDPVPDE RLQVAMAEDL VGKLAVPYRD       180
     RLARVPHVPS LAYRLAMIAD GRIDGTIVKK NAHDWDLAAA DLILARAGGA LRGLDGMPLS       240
     YNRPIVSHGV LGAGSGLALP SLLAASRPFD AH                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page