(data stored in ACNUC7421 zone)

EMBL: CP001389.PE416

CP001389.PE416       Location/Qualifiers
FT   CDS             475219..475455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24220"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV5"
FT                   /protein_id="ACP24220.1"
FT                   /translation="MAQNTEKKQLLHLVFGGELTTLTDVQFRDLNDLDIVGIFPDYESA
FT                   HVAWKAKAQMTVDNAHMRYFIVHMHRLLDPEHD"
     MAQNTEKKQL LHLVFGGELT TLTDVQFRDL NDLDIVGIFP DYESAHVAWK AKAQMTVDNA        60
     HMRYFIVHMH RLLDPEHD                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page