(data stored in ACNUC7421 zone)

EMBL: CP001389.PE420

CP001389.PE420       Location/Qualifiers
FT   CDS             complement(478721..478954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24224"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV9"
FT                   /protein_id="ACP24224.1"
FT                   /translation="MMNRFDGNSSREAKIRYLDGDFQIVLAGSHVVCAMTGKAIPVDEL
FT                   RYWSVSRQEPYIDADASLEAERRAGALPRQQA"
     MMNRFDGNSS REAKIRYLDG DFQIVLAGSH VVCAMTGKAI PVDELRYWSV SRQEPYIDAD        60
     ASLEAERRAG ALPRQQA                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page