(data stored in ACNUC7421 zone)

EMBL: CP001389.PE422

CP001389.PE422       Location/Qualifiers
FT   CDS             481256..482980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04300"
FT                   /product="putative two-component sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24226"
FT                   /db_xref="GOA:C3MGW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW1"
FT                   /protein_id="ACP24226.1"
FT                   /translation="MNDVASGGADISRIVLESSCDALGLALLVCGRDDTILHASASMLQ
FT                   FFPVQPHLLKPGTRLRDFLGAVYDTGLRPGTLPESSRRRANREDWIAEQMGLHWRERYE
FT                   SVERAGRTRWICLRKRRLSSGMGILSVSDVSDQKKREEQLHTDLERVELTEQILDAQPN
FT                   PICVKDRNLNYIAANKAFCAIHDVAPEAILGRSAWDVVDAELAERFEQSDRHVLATGRP
FT                   HSEAEHIVRADGSDLWVVTRKYRVGVPGRHFVVTCMNDVTDIAAWYHGAEDGGGNSGLQ
FT                   IRDYSIFTPAQNFYDPFRALNVQQLVDAGSMIETLPARGLRVLLATADREMEDRIVARL
FT                   RGSGLDACAVRNREELDAFAATAGDCGVKLDILALDTALPARDAILAGWKTCPVLEVSS
FT                   QADATTLLGEIFKACTDRHQARSHFPPADWEVSFEGDATARTSASEVEVLVAEDNQINQ
FT                   FVFAQILDGLGVSYRIAANGREAVELWQELQPSLVLMDISMPVMNGFEAAAAIRDAESQ
FT                   TGRRTPIIAVTAQALDIDLKRCEASGMDDHIMKPISPDMIEALLRKHMRPATVRLTA"
     MNDVASGGAD ISRIVLESSC DALGLALLVC GRDDTILHAS ASMLQFFPVQ PHLLKPGTRL        60
     RDFLGAVYDT GLRPGTLPES SRRRANREDW IAEQMGLHWR ERYESVERAG RTRWICLRKR       120
     RLSSGMGILS VSDVSDQKKR EEQLHTDLER VELTEQILDA QPNPICVKDR NLNYIAANKA       180
     FCAIHDVAPE AILGRSAWDV VDAELAERFE QSDRHVLATG RPHSEAEHIV RADGSDLWVV       240
     TRKYRVGVPG RHFVVTCMND VTDIAAWYHG AEDGGGNSGL QIRDYSIFTP AQNFYDPFRA       300
     LNVQQLVDAG SMIETLPARG LRVLLATADR EMEDRIVARL RGSGLDACAV RNREELDAFA       360
     ATAGDCGVKL DILALDTALP ARDAILAGWK TCPVLEVSSQ ADATTLLGEI FKACTDRHQA       420
     RSHFPPADWE VSFEGDATAR TSASEVEVLV AEDNQINQFV FAQILDGLGV SYRIAANGRE       480
     AVELWQELQP SLVLMDISMP VMNGFEAAAA IRDAESQTGR RTPIIAVTAQ ALDIDLKRCE       540
     ASGMDDHIMK PISPDMIEAL LRKHMRPATV RLTA                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page