(data stored in ACNUC7421 zone)

EMBL: CP001389.PE423

CP001389.PE423       Location/Qualifiers
FT   CDS             483406..484746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04310"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24227"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW2"
FT                   /protein_id="ACP24227.1"
FT                   /translation="MILAELASDRRGPDRLPFVDPLTGLGNAQQLRHKVCELAAERASD
FT                   PAPFTIGLANLDGFKPINDLFGPEAGDRILRQVAQRLTACVPEGATVIRTADDEFALVL
FT                   PLVFERKSAEKLGQMLKEILSAPFDLGDRTVRLSASFGFAVYPFAGAEFEDLLKSADTA
FT                   LYRSKRRGRGQITVYSQEIAQEMKRATQLEQALRNAIIAEEIDVHFQPIVDLRNDGVVG
FT                   FEALARWCDPEFGYVSPSVFVPLAEERGFIEALAEMLLRKAAQTALAWPKELFLSFNLS
FT                   SAQLMDPATSGRLLAIVHQVGLDPRRLELEITETAVMADADVAQKIVSELRAAGVRVSL
FT                   DDFGTGQSSLCRLRDFSFDKVKIDRAFVSRISADRASEHIVKAIVSMCEGLELEVVAEG
FT                   IEDISEVLKLKALGCGMGQGYFYGKPADAVATLRYLSDRHREPAAAR"
     MILAELASDR RGPDRLPFVD PLTGLGNAQQ LRHKVCELAA ERASDPAPFT IGLANLDGFK        60
     PINDLFGPEA GDRILRQVAQ RLTACVPEGA TVIRTADDEF ALVLPLVFER KSAEKLGQML       120
     KEILSAPFDL GDRTVRLSAS FGFAVYPFAG AEFEDLLKSA DTALYRSKRR GRGQITVYSQ       180
     EIAQEMKRAT QLEQALRNAI IAEEIDVHFQ PIVDLRNDGV VGFEALARWC DPEFGYVSPS       240
     VFVPLAEERG FIEALAEMLL RKAAQTALAW PKELFLSFNL SSAQLMDPAT SGRLLAIVHQ       300
     VGLDPRRLEL EITETAVMAD ADVAQKIVSE LRAAGVRVSL DDFGTGQSSL CRLRDFSFDK       360
     VKIDRAFVSR ISADRASEHI VKAIVSMCEG LELEVVAEGI EDISEVLKLK ALGCGMGQGY       420
     FYGKPADAVA TLRYLSDRHR EPAAAR                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page