(data stored in ACNUC7421 zone)

EMBL: CP001389.PE43

CP001389.PE43        Location/Qualifiers
FT   CDS             45743..46264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23847"
FT                   /db_xref="GOA:C3MF10"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF10"
FT                   /protein_id="ACP23847.1"
FT                   /translation="MTALDIQISVEEGDWPSEDELQGLSTRILDVTVAFLIAEEKQPFP
FT                   DDPPELSLVFTDDQSIREINAEWRNQDKPTNVLSFPAFPVTPGNMPGPMLGDIIVAYET
FT                   LEREAAEMEKPFEEHLTHLLVHGFLHLFGYDHIEDDEAERMEGLETRILARLGLSDPYG
FT                   DQPRIDSLEQ"
     MTALDIQISV EEGDWPSEDE LQGLSTRILD VTVAFLIAEE KQPFPDDPPE LSLVFTDDQS        60
     IREINAEWRN QDKPTNVLSF PAFPVTPGNM PGPMLGDIIV AYETLEREAA EMEKPFEEHL       120
     THLLVHGFLH LFGYDHIEDD EAERMEGLET RILARLGLSD PYGDQPRIDS LEQ              173
//

If you have problems or comments...

PBIL Back to PBIL home page