(data stored in ACNUC7421 zone)

EMBL: CP001389.PE433

CP001389.PE433       Location/Qualifiers
FT   CDS             494233..495384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04410"
FT                   /product="putative ATP-binding Mrp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24237"
FT                   /db_xref="GOA:C3MGX2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGX2"
FT                   /protein_id="ACP24237.1"
FT                   /translation="MPDVTREMVLEKLRGVRGPDMEGNIVDLGLVSDVFISDGKAYFSI
FT                   TVPADRAKELEPMRAAAERVVREIPGVKAAMVALTADRKAAPQAAPVQRPAPPSGHAHA
FT                   PRPAGGAPAKAGIPGVGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGP
FT                   SMPRLLKISGRPQQIEGRLIRPMENYGLRVMSMGFLVDEEVAMIWRGPMIQSALLQMLR
FT                   EVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALADARKGITMFRKVE
FT                   VPVLGIVENMSYFVAPDTGNRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGT
FT                   PLVVSDPDGEVARIYRGIAERVWEQLSAGQGSKSRAMPNIVFE"
     MPDVTREMVL EKLRGVRGPD MEGNIVDLGL VSDVFISDGK AYFSITVPAD RAKELEPMRA        60
     AAERVVREIP GVKAAMVALT ADRKAAPQAA PVQRPAPPSG HAHAPRPAGG APAKAGIPGV       120
     GAIIAVASGK GGVGKSTTSV NLALALQANG LKVGLLDADI YGPSMPRLLK ISGRPQQIEG       180
     RLIRPMENYG LRVMSMGFLV DEEVAMIWRG PMIQSALLQM LREVAWGELD VLVVDMPPGT       240
     GDAQLTMAQQ VPLAGAVIVS TPQDLALADA RKGITMFRKV EVPVLGIVEN MSYFVAPDTG       300
     NRYDIFGHGG ARKEAERIGV PFLGEVPLTM GIRETSDAGT PLVVSDPDGE VARIYRGIAE       360
     RVWEQLSAGQ GSKSRAMPNI VFE                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page