(data stored in ACNUC7421 zone)

EMBL: CP001389.PE434

CP001389.PE434       Location/Qualifiers
FT   CDS             495547..495732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24238"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB0"
FT                   /protein_id="ACP24238.1"
FT                   /translation="MPCRSRRGRCLALLAGDFCPDDDQAEMSWGESLHQMNRHCGNPVA
FT                   ADRFNSSWFASQKAAA"
     MPCRSRRGRC LALLAGDFCP DDDQAEMSWG ESLHQMNRHC GNPVAADRFN SSWFASQKAA        60
     A                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page