(data stored in ACNUC7421 zone)

EMBL: CP001389.PE435

CP001389.PE435       Location/Qualifiers
FT   CDS             495702..496706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04430"
FT                   /product="putative magnesium/cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24239"
FT                   /db_xref="GOA:C3MHB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB1"
FT                   /protein_id="ACP24239.1"
FT                   /translation="MVRLPKGGRMISGYCVNGEAVALSTAEPPAALRPEIVWIDLVEPT
FT                   RAEELMMEGLLGISIPTRDDLKGIEPSSRLYVEDGAVFMTASLIYRSETQIAGLTDVGF
FT                   ILSGGRLVTIRYAEPRVFGLFKAGLHRIPGGCRNGVVILTRLLETISDRTSEILEQAVD
FT                   KIDDLSIEVFGDRAAGRRRPPQLLEARLRDVAGFHRLVAKTRDSLASLSRLLTFLYTVP
FT                   EVQEDKYSRELCRSISRDIQSLSEHAAFISGNITFLLDASLGLINVEQNAIIKIFSIAS
FT                   VVLLPPTLVASVYGMNFRVMPELEWQFGYPWALAAMVLSAIIPFFFFRWKGWL"
     MVRLPKGGRM ISGYCVNGEA VALSTAEPPA ALRPEIVWID LVEPTRAEEL MMEGLLGISI        60
     PTRDDLKGIE PSSRLYVEDG AVFMTASLIY RSETQIAGLT DVGFILSGGR LVTIRYAEPR       120
     VFGLFKAGLH RIPGGCRNGV VILTRLLETI SDRTSEILEQ AVDKIDDLSI EVFGDRAAGR       180
     RRPPQLLEAR LRDVAGFHRL VAKTRDSLAS LSRLLTFLYT VPEVQEDKYS RELCRSISRD       240
     IQSLSEHAAF ISGNITFLLD ASLGLINVEQ NAIIKIFSIA SVVLLPPTLV ASVYGMNFRV       300
     MPELEWQFGY PWALAAMVLS AIIPFFFFRW KGWL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page