(data stored in ACNUC7421 zone)

EMBL: CP001389.PE436

CP001389.PE436       Location/Qualifiers
FT   CDS             496722..498623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04440"
FT                   /product="potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24240"
FT                   /db_xref="GOA:C3MHB2"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB2"
FT                   /protein_id="ACP24240.1"
FT                   /translation="MSQSSAPAVHGSENARRLLALALGSIGVVYGDIGTSPLYAFREAL
FT                   RPLAHDGVTDVEIIGLISMMIWSLTIIVTIKYVLFLLRADNQGEGGTLSLLALLMKTAN
FT                   GHTWLLFFMGVAGAALFIGDAMITPALSVLSAVEGLKLVTPALSDYVVPIAVVILLLLF
FT                   AVQSKGTAAVSNFFGPITLVWFLVMGGIGLVHIADDLSIFSAFNPFYAATFLFNEGYVG
FT                   VIVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFVIVFPALTLNYLGQGAFILEHPEAM
FT                   SDPFFLMFPKWALLPVVILATAATIIASQAVITGAFSLTRQAIHLGFLPRMAIFHTSET
FT                   HTGQIYLPNVNTLLMFGVMALVFVFGSSEALATAYGISVTGAMVVTTLLAFEFLRARWN
FT                   WSAWWAAAALLPLLALEFVFLGANMLKIHDGGYVPILIAATFIIVMWTWKRGTQILHAK
FT                   TRHIDIPLASFIKSIERKSEHAPVAVPGTAIFLTSDPDSTPAALLHNIKHNHVLHQQNF
FT                   ILTVRTANTPKVPKEERVSVRPLSERFTLLEMKFGYMETQNVSQALGLFRKSGLKFDIM
FT                   STSFYLGRRKLVPDAQSGMPHWQDRLFIALANAAIDPSDYFRLPTNRVVELGSHVII"
     MSQSSAPAVH GSENARRLLA LALGSIGVVY GDIGTSPLYA FREALRPLAH DGVTDVEIIG        60
     LISMMIWSLT IIVTIKYVLF LLRADNQGEG GTLSLLALLM KTANGHTWLL FFMGVAGAAL       120
     FIGDAMITPA LSVLSAVEGL KLVTPALSDY VVPIAVVILL LLFAVQSKGT AAVSNFFGPI       180
     TLVWFLVMGG IGLVHIADDL SIFSAFNPFY AATFLFNEGY VGVIVLGAVF LTVTGAEALY       240
     ADLGHFGRRP IQWAWFVIVF PALTLNYLGQ GAFILEHPEA MSDPFFLMFP KWALLPVVIL       300
     ATAATIIASQ AVITGAFSLT RQAIHLGFLP RMAIFHTSET HTGQIYLPNV NTLLMFGVMA       360
     LVFVFGSSEA LATAYGISVT GAMVVTTLLA FEFLRARWNW SAWWAAAALL PLLALEFVFL       420
     GANMLKIHDG GYVPILIAAT FIIVMWTWKR GTQILHAKTR HIDIPLASFI KSIERKSEHA       480
     PVAVPGTAIF LTSDPDSTPA ALLHNIKHNH VLHQQNFILT VRTANTPKVP KEERVSVRPL       540
     SERFTLLEMK FGYMETQNVS QALGLFRKSG LKFDIMSTSF YLGRRKLVPD AQSGMPHWQD       600
     RLFIALANAA IDPSDYFRLP TNRVVELGSH VII                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page