(data stored in ACNUC7421 zone)

EMBL: CP001389.PE438

CP001389.PE438       Location/Qualifiers
FT   CDS             500210..500635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04460"
FT                   /product="putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24242"
FT                   /db_xref="GOA:C3MHB4"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB4"
FT                   /protein_id="ACP24242.1"
FT                   /translation="MSTGRLYDRDRVRPRGAAKGSHVTEKPEESLEARLKRLGEDIASK
FT                   RVDVSDEAEVRSAESRKGYAAAMKLSSEFIAGIVVGAFLGYLLDHFAGTGPWGMIVLLL
FT                   LGFCAGVLNVLRSAGLVATPDQRGGSPGNSKKDGDGA"
     MSTGRLYDRD RVRPRGAAKG SHVTEKPEES LEARLKRLGE DIASKRVDVS DEAEVRSAES        60
     RKGYAAAMKL SSEFIAGIVV GAFLGYLLDH FAGTGPWGMI VLLLLGFCAG VLNVLRSAGL       120
     VATPDQRGGS PGNSKKDGDG A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page