(data stored in ACNUC7421 zone)

EMBL: CP001389.PE44

CP001389.PE44        Location/Qualifiers
FT   CDS             46261..47421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00440"
FT                   /product="putative hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23848"
FT                   /db_xref="GOA:C3MF11"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF11"
FT                   /protein_id="ACP23848.1"
FT                   /translation="MSDFKTQPATVASEEADASGDADAGSSSTTARPEGSKPISSFWSR
FT                   AARLWRGAGASSLREDLADALMTDADSNTAFSPEERAMLNNILRFREIRVEDVMVPRAD
FT                   IEAVDQSITLGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTRQARNRRRNG
FT                   KAPHAVGADRAEKSPRQPRPGFDLSRVDLNKTVEEVSIIRQVLFVPPSMLASDLMQRMQ
FT                   AARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEVMFARTSDDVFVADARVE
FT                   LEEIAEAIGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDADPRR
FT                   VKRVRIMRKRPPARRRVVKPEKETLPDALPANGGAQANASPPTTAE"
     MSDFKTQPAT VASEEADASG DADAGSSSTT ARPEGSKPIS SFWSRAARLW RGAGASSLRE        60
     DLADALMTDA DSNTAFSPEE RAMLNNILRF REIRVEDVMV PRADIEAVDQ SITLGELMVL       120
     FEESGRSRMP VYSEGLDDPR GMVHIRDLLA YVTRQARNRR RNGKAPHAVG ADRAEKSPRQ       180
     PRPGFDLSRV DLNKTVEEVS IIRQVLFVPP SMLASDLMQR MQAARIQMAL VIDEYGGTDG       240
     LVSLEDIVEM VVGDIEDEHD DDEVMFARTS DDVFVADARV ELEEIAEAIG PDFDVREQLE       300
     DVDTLGGLVF ASLGRIPVRG EVVQAIPGFE FQILDADPRR VKRVRIMRKR PPARRRVVKP       360
     EKETLPDALP ANGGAQANAS PPTTAE                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page