(data stored in ACNUC7421 zone)

EMBL: CP001389.PE445

CP001389.PE445       Location/Qualifiers
FT   CDS             complement(504972..506129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04530"
FT                   /product="radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24249"
FT                   /db_xref="GOA:C3MHC1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC1"
FT                   /protein_id="ACP24249.1"
FT                   /translation="MTELSQLRQGAFAPGNSAELAEAIVTGTGVRIEIDRRRGRGAALN
FT                   MSGRYEPRTRDAFDDGWQTIEELPPFKTEVQVEKPRNVITRNESPDISFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFEAKLFAKPDAPRLLERELAKPDYKVRPIAIGTNTD
FT                   PYQPIEKEWRIMRQILEVLKAANHPVMIVTKSAMVTRDIDLLAPMAEKGLARVGISVTT
FT                   LDRKLARAMEPRASTPPKRLEAIRAVSEAGIPAGVLVAPIIPALNDHEIERVLDAAKTA
FT                   GAAEASYVLLRLPLEVSPLFRDWLLRNYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGA
FT                   GPYAWQIGRRFELAAKRLELNLTRRQLRHDIFVPPLGMGVQLSLL"
     MTELSQLRQG AFAPGNSAEL AEAIVTGTGV RIEIDRRRGR GAALNMSGRY EPRTRDAFDD        60
     GWQTIEELPP FKTEVQVEKP RNVITRNESP DISFDRSINP YRGCEHGCIY CFARPTHAYM       120
     GLSAGLDFEA KLFAKPDAPR LLERELAKPD YKVRPIAIGT NTDPYQPIEK EWRIMRQILE       180
     VLKAANHPVM IVTKSAMVTR DIDLLAPMAE KGLARVGISV TTLDRKLARA MEPRASTPPK       240
     RLEAIRAVSE AGIPAGVLVA PIIPALNDHE IERVLDAAKT AGAAEASYVL LRLPLEVSPL       300
     FRDWLLRNYP DRYRHVMSLV RSMRGGKDYD AEFGKRMKGA GPYAWQIGRR FELAAKRLEL       360
     NLTRRQLRHD IFVPPLGMGV QLSLL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page