(data stored in ACNUC7421 zone)

EMBL: CP001389.PE447

CP001389.PE447       Location/Qualifiers
FT   CDS             complement(507121..507663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04550"
FT                   /product="putative molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24251"
FT                   /db_xref="GOA:C3MHC3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC3"
FT                   /protein_id="ACP24251.1"
FT                   /translation="MPGIDEARPFIPVGIAVLTVSDTRTRADDKSGDTLEASIRDAGHR
FT                   LEARAIVRDDRREIYDQVKAWTLDASIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SEVFHRISYDKIGTSTIQSRATGGVANATFIFVLPGSPGACKDAWDGILKQQLDYRHMP
FT                   CNFVEIMPRLDEHLKRG"
     MPGIDEARPF IPVGIAVLTV SDTRTRADDK SGDTLEASIR DAGHRLEARA IVRDDRREIY        60
     DQVKAWTLDA SIDVVITTGG TGFTGRDVTP EALEPLFEKR MDGFSEVFHR ISYDKIGTST       120
     IQSRATGGVA NATFIFVLPG SPGACKDAWD GILKQQLDYR HMPCNFVEIM PRLDEHLKRG       180
//

If you have problems or comments...

PBIL Back to PBIL home page