(data stored in ACNUC7421 zone)

EMBL: CP001389.PE449

CP001389.PE449       Location/Qualifiers
FT   CDS             complement(508583..510403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04570"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24253"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC5"
FT                   /protein_id="ACP24253.1"
FT                   /translation="MRHNTFLRLLGGAAMLALLCVTGSHQAFAEDKAAVEDARPFDIRG
FT                   VNTFAGAFLAARTADVDRDFETATELYRIALRFEPENTEVKQRLMITLLMSGKFDEGVK
FT                   IAEALKSDPAVERITTTVRAIESIRKREYRSAQKLLNYQGPNDLDRLMSTLLSAWAKAG
FT                   QGRPKEAIAQIKALEGPEWFRVFKNYHTGAIALVAGDKTTARSRLNDAILDREGGSAAP
FT                   DTFMRAVEALARFEAREGNKQKALDTVSVGESLVNNYTPLEALRESIEKGEPQEQQVRN
FT                   AAQGAAAVLFSIGGALNREGAEDIVTLYLQTARRLDPESADILVMLGGIAENLKKQDEA
FT                   IALYKSVPAESPMRRVSELQLGLALASVGKVDEAKKHLQALIEVDPKNIRNYLAYGSVL
FT                   SDAKAYKEMGDLYDRAVEAIGPVPKRSDWTVFFQRGIAYERQKIWEKAEPSFLKALELN
FT                   PNQPQVLNYLGYSWVDMNINLDKGLEMIRKAVELKPDDGYIVDSLGWAYFRMNRFDEAV
FT                   TELERAAELMAGDPTINDHLGDAYWRVGRKLEAVFQWNQALEMKPEEAEVSKIKAKIEN
FT                   GLPALKQDVPAAADAKETLPKKPAAPDKKS"
     MRHNTFLRLL GGAAMLALLC VTGSHQAFAE DKAAVEDARP FDIRGVNTFA GAFLAARTAD        60
     VDRDFETATE LYRIALRFEP ENTEVKQRLM ITLLMSGKFD EGVKIAEALK SDPAVERITT       120
     TVRAIESIRK REYRSAQKLL NYQGPNDLDR LMSTLLSAWA KAGQGRPKEA IAQIKALEGP       180
     EWFRVFKNYH TGAIALVAGD KTTARSRLND AILDREGGSA APDTFMRAVE ALARFEAREG       240
     NKQKALDTVS VGESLVNNYT PLEALRESIE KGEPQEQQVR NAAQGAAAVL FSIGGALNRE       300
     GAEDIVTLYL QTARRLDPES ADILVMLGGI AENLKKQDEA IALYKSVPAE SPMRRVSELQ       360
     LGLALASVGK VDEAKKHLQA LIEVDPKNIR NYLAYGSVLS DAKAYKEMGD LYDRAVEAIG       420
     PVPKRSDWTV FFQRGIAYER QKIWEKAEPS FLKALELNPN QPQVLNYLGY SWVDMNINLD       480
     KGLEMIRKAV ELKPDDGYIV DSLGWAYFRM NRFDEAVTEL ERAAELMAGD PTINDHLGDA       540
     YWRVGRKLEA VFQWNQALEM KPEEAEVSKI KAKIENGLPA LKQDVPAAAD AKETLPKKPA       600
     APDKKS                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page