(data stored in ACNUC7421 zone)

EMBL: CP001389.PE45

CP001389.PE45        Location/Qualifiers
FT   CDS             complement(47425..48000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23849"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF12"
FT                   /protein_id="ACP23849.1"
FT                   /translation="MFDSREKIALFIDGANLYATSKSLGFDIDYRKLLSAFQKRAYLVR
FT                   AYYYTALIEDLEFSSIRPLIDWLDYNGYTVVTKPAKEFTDALGRRKIKGSMDVELAIDA
FT                   LEQRQVVDHYVLFSGDGNFTTLVAALQRNGRKVTVVSTLSTQPPMIADELRRQADHFID
FT                   LIALRSEIDRHPQAAPQTVKPADESVNS"
     MFDSREKIAL FIDGANLYAT SKSLGFDIDY RKLLSAFQKR AYLVRAYYYT ALIEDLEFSS        60
     IRPLIDWLDY NGYTVVTKPA KEFTDALGRR KIKGSMDVEL AIDALEQRQV VDHYVLFSGD       120
     GNFTTLVAAL QRNGRKVTVV STLSTQPPMI ADELRRQADH FIDLIALRSE IDRHPQAAPQ       180
     TVKPADESVN S                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page