(data stored in ACNUC7421 zone)

EMBL: CP001389.PE451

CP001389.PE451       Location/Qualifiers
FT   CDS             511699..511920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24255"
FT                   /db_xref="GOA:C3MHC7"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC7"
FT                   /protein_id="ACP24255.1"
FT                   /translation="MKELIRTNDAVLLSFAESLMKDAGIPCLIADRDMSILEGSLGLLP
FT                   RRFLVADDDADRARRILIDAGLEKELRQ"
     MKELIRTNDA VLLSFAESLM KDAGIPCLIA DRDMSILEGS LGLLPRRFLV ADDDADRARR        60
     ILIDAGLEKE LRQ                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page