(data stored in ACNUC7421 zone)

EMBL: CP001389.PE452

CP001389.PE452       Location/Qualifiers
FT   CDS             511970..512743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04600"
FT                   /product="putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24256"
FT                   /db_xref="GOA:C3MHC8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC8"
FT                   /protein_id="ACP24256.1"
FT                   /translation="MTTTAESVDSFHRGKFHLIQPLGQGHRSGMDAMLLAALVSCERPC
FT                   RVADLGAGAGAAGMAVASRLAEAEVLLVERSAIMADFARRSLALPENARFASRVAVLEA
FT                   DVSLNGKARAAVGLPDDAFDHVIMNPPFNDAADRRTPDSLKAEAHAMSDDLFETWIKTA
FT                   GAIMKPGGQLSLIARPESIAEIIAACGRRFGGIEITPLLPRAGENAVRILVTAIKQSRK
FT                   RLVLRAPLIMHAEGTHRFSPEIDDLNNGREAYRRR"
     MTTTAESVDS FHRGKFHLIQ PLGQGHRSGM DAMLLAALVS CERPCRVADL GAGAGAAGMA        60
     VASRLAEAEV LLVERSAIMA DFARRSLALP ENARFASRVA VLEADVSLNG KARAAVGLPD       120
     DAFDHVIMNP PFNDAADRRT PDSLKAEAHA MSDDLFETWI KTAGAIMKPG GQLSLIARPE       180
     SIAEIIAACG RRFGGIEITP LLPRAGENAV RILVTAIKQS RKRLVLRAPL IMHAEGTHRF       240
     SPEIDDLNNG REAYRRR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page