(data stored in ACNUC7421 zone)

EMBL: CP001389.PE457

CP001389.PE457       Location/Qualifiers
FT   CDS             515656..516204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04650"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24261"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD3"
FT                   /protein_id="ACP24261.1"
FT                   /translation="MIGLAIGVAVILYLVFVYNGLVKARQMAEEAWSGIDVQLKRRADL
FT                   IPNLIETVKGYAAHEKSTLEEVVALRNRAQAVPEGDIAARAAAEGALSQALGRLFALAE
FT                   AYPDLKANENFVELQRSLETIEGEIQMSRRYYNGAARDLNVKVESFPSNLIAGTFRFAK
FT                   ASYFEITNEADRAVPSVKF"
     MIGLAIGVAV ILYLVFVYNG LVKARQMAEE AWSGIDVQLK RRADLIPNLI ETVKGYAAHE        60
     KSTLEEVVAL RNRAQAVPEG DIAARAAAEG ALSQALGRLF ALAEAYPDLK ANENFVELQR       120
     SLETIEGEIQ MSRRYYNGAA RDLNVKVESF PSNLIAGTFR FAKASYFEIT NEADRAVPSV       180
     KF                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page