(data stored in ACNUC7421 zone)

EMBL: CP001389.PE458

CP001389.PE458       Location/Qualifiers
FT   CDS             516229..518166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24262"
FT                   /db_xref="GOA:C3MHD4"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD4"
FT                   /protein_id="ACP24262.1"
FT                   /translation="MKRLLAALAFVLMVLAAPCPAAAEEIISSYHSVIDVAKDGTLTVT
FT                   ETITANVEGNQIRRGIYRDFPLTFIDPDGRRVRVDFKLVSVERDGEQEEYRTESISGGI
FT                   RIYTGNADVFLPRGEHIFQLTYETSRQIRFFNDHDELYWNVTGTEWAFPIEEATATVTL
FT                   PDGVVAQALDVFTGGYGATGKDARAVEEGGEIFFATTRRLRPQEGLTIAIKLPKGSIDR
FT                   PSPSQQNIWWLRDHLAVVIAGAGLVAVGLYYGRAWVRVGRDPARGVMVPRWDPPDGISP
FT                   ALVNYIDNKGFSGEGWTALSAAALSLAVKGYVVLDDLKNAIIVSATGKSGGEKLPTGEA
FT                   ALMKSVEAAGGTLKIDRANGKAVADAGSSFRSAMEREHRGKYYQANVGYITGGVVLSIV
FT                   ALAALFIFGELGEETIPFIVVPVFVAVFVSGFAVSVGKSLRRGSSLMRRIMSIVVLAFI
FT                   GFVLVAVFSSILAVVMFSATEPDDLPLFFAVGGIVLVNGLFYYLMGAPTPLGTRMMDGI
FT                   DGLRQYLTLAEQDRLNMQGVPEMSPRHFETLLPYAVALGVEKPWTETFDRWLLAAAGGA
FT                   AAAAYQPSWYHGDSFGPGSFSDTIGGFAGSMADTMTSSLPPPPKSSSSGFSSGGGFSGG
FT                   GGGGGGGGGW"
     MKRLLAALAF VLMVLAAPCP AAAEEIISSY HSVIDVAKDG TLTVTETITA NVEGNQIRRG        60
     IYRDFPLTFI DPDGRRVRVD FKLVSVERDG EQEEYRTESI SGGIRIYTGN ADVFLPRGEH       120
     IFQLTYETSR QIRFFNDHDE LYWNVTGTEW AFPIEEATAT VTLPDGVVAQ ALDVFTGGYG       180
     ATGKDARAVE EGGEIFFATT RRLRPQEGLT IAIKLPKGSI DRPSPSQQNI WWLRDHLAVV       240
     IAGAGLVAVG LYYGRAWVRV GRDPARGVMV PRWDPPDGIS PALVNYIDNK GFSGEGWTAL       300
     SAAALSLAVK GYVVLDDLKN AIIVSATGKS GGEKLPTGEA ALMKSVEAAG GTLKIDRANG       360
     KAVADAGSSF RSAMEREHRG KYYQANVGYI TGGVVLSIVA LAALFIFGEL GEETIPFIVV       420
     PVFVAVFVSG FAVSVGKSLR RGSSLMRRIM SIVVLAFIGF VLVAVFSSIL AVVMFSATEP       480
     DDLPLFFAVG GIVLVNGLFY YLMGAPTPLG TRMMDGIDGL RQYLTLAEQD RLNMQGVPEM       540
     SPRHFETLLP YAVALGVEKP WTETFDRWLL AAAGGAAAAA YQPSWYHGDS FGPGSFSDTI       600
     GGFAGSMADT MTSSLPPPPK SSSSGFSSGG GFSGGGGGGG GGGGW                       645
//

If you have problems or comments...

PBIL Back to PBIL home page