(data stored in ACNUC7421 zone)

EMBL: CP001389.PE462

CP001389.PE462       Location/Qualifiers
FT   CDS             521835..522044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24266"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD8"
FT                   /protein_id="ACP24266.1"
FT                   /translation="MVGDLVFLLLAALPLMGSPGPATLSLCGHGRRARHFPQPALCCRN
FT                   QCRYHKCGSVDCDGDDGHRAVCRE"
     MVGDLVFLLL AALPLMGSPG PATLSLCGHG RRARHFPQPA LCCRNQCRYH KCGSVDCDGD        60
     DGHRAVCRE                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page