(data stored in ACNUC7421 zone)

EMBL: CP001389.PE463

CP001389.PE463       Location/Qualifiers
FT   CDS             522047..522427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24267"
FT                   /db_xref="GOA:C3MHD9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD9"
FT                   /protein_id="ACP24267.1"
FT                   /translation="MAATVIGGLYMLYLALRIATAPPVAAEQGTHLPSFLGGFVLAIAN
FT                   PKAYAAIGSLYVGSLVDAQQGTRAAVGSVVVLAFVAVALNTTWLAFGAAIAAVLRDPRK
FT                   ARIANLVFALLLLASLVPLLLS"
     MAATVIGGLY MLYLALRIAT APPVAAEQGT HLPSFLGGFV LAIANPKAYA AIGSLYVGSL        60
     VDAQQGTRAA VGSVVVLAFV AVALNTTWLA FGAAIAAVLR DPRKARIANL VFALLLLASL       120
     VPLLLS                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page