(data stored in ACNUC7421 zone)

EMBL: CP001389.PE464

CP001389.PE464       Location/Qualifiers
FT   CDS             522473..522979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24268"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE0"
FT                   /protein_id="ACP24268.1"
FT                   /translation="MTAKILVSACLMGHAVRYDGAAKPLCHPALERWRAEGRLVTLCPE
FT                   MSAGMPVPRPPAEIEAGKTGASILSGSGRVLEKTGSDVTEAFRHGAENALALARATNCR
FT                   FALLIDGSPSCGSSLVYDGSFNGERVRGEGVTAALLRRNGIEVFSDREVDMLVERLARD
FT                   DEAAP"
     MTAKILVSAC LMGHAVRYDG AAKPLCHPAL ERWRAEGRLV TLCPEMSAGM PVPRPPAEIE        60
     AGKTGASILS GSGRVLEKTG SDVTEAFRHG AENALALARA TNCRFALLID GSPSCGSSLV       120
     YDGSFNGERV RGEGVTAALL RRNGIEVFSD REVDMLVERL ARDDEAAP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page