(data stored in ACNUC7421 zone)

EMBL: CP001389.PE465

CP001389.PE465       Location/Qualifiers
FT   CDS             complement(523088..523585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24269"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE1"
FT                   /protein_id="ACP24269.1"
FT                   /translation="MRSLLITAALTLAAGTATASSVEDVASGQAVNASVATISCAECPP
FT                   LQPKKKASYVVPELAPGTAKLEVKEINGEMKSVRTEAWLGGSPVVFVNKASEEAIKAAA
FT                   IKADPASAGAAEASVAAVADIDQTAKTAAVGIVSHAEPVSASMAGSGSQEFDPSGFELR
FT                   LD"
     MRSLLITAAL TLAAGTATAS SVEDVASGQA VNASVATISC AECPPLQPKK KASYVVPELA        60
     PGTAKLEVKE INGEMKSVRT EAWLGGSPVV FVNKASEEAI KAAAIKADPA SAGAAEASVA       120
     AVADIDQTAK TAAVGIVSHA EPVSASMAGS GSQEFDPSGF ELRLD                       165
//

If you have problems or comments...

PBIL Back to PBIL home page