(data stored in ACNUC7421 zone)

EMBL: CP001389.PE468

CP001389.PE468       Location/Qualifiers
FT   CDS             complement(527435..528475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04760"
FT                   /product="putative spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24272"
FT                   /db_xref="GOA:C3MHE4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE4"
FT                   /protein_id="ACP24272.1"
FT                   /translation="MRRRAATSVFLATLLCAAASRAETLNLLIWEAYIDQGLIDRWTQK
FT                   TGVSIHQINFDSDDARDEVLADPSNNIDLVVVDENGAHLFGKKGVLETLNEANLPALAD
FT                   YAPEWRDRCAGSGLPYFSGTVGILYRSDVIAEPPTSWQELMRPAASLKKHVAMFDDHTE
FT                   LFVPPLMLLGASINTSDTGTLKAAFDLLKAQAPAVLTYDYVITAIQDQTSGKEIHMALG
FT                   YSGDQHVLNDKVSKPGLWRYSVPREGTLSWLDCVSVIAGSPRKQHALEFLDFIGSPESA
FT                   AANALALTMPTTSSAALKLLPEAMRSDPEIYPPATTLAKSQYQQELSIQSVQARRRIIS
FT                   TLANFQ"
     MRRRAATSVF LATLLCAAAS RAETLNLLIW EAYIDQGLID RWTQKTGVSI HQINFDSDDA        60
     RDEVLADPSN NIDLVVVDEN GAHLFGKKGV LETLNEANLP ALADYAPEWR DRCAGSGLPY       120
     FSGTVGILYR SDVIAEPPTS WQELMRPAAS LKKHVAMFDD HTELFVPPLM LLGASINTSD       180
     TGTLKAAFDL LKAQAPAVLT YDYVITAIQD QTSGKEIHMA LGYSGDQHVL NDKVSKPGLW       240
     RYSVPREGTL SWLDCVSVIA GSPRKQHALE FLDFIGSPES AAANALALTM PTTSSAALKL       300
     LPEAMRSDPE IYPPATTLAK SQYQQELSIQ SVQARRRIIS TLANFQ                      346
//

If you have problems or comments...

PBIL Back to PBIL home page