(data stored in ACNUC7421 zone)

EMBL: CP001389.PE469

CP001389.PE469       Location/Qualifiers
FT   CDS             complement(528584..529777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04770"
FT                   /product="putative transmembrane MFS family transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24273"
FT                   /db_xref="GOA:C3MHE5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE5"
FT                   /protein_id="ACP24273.1"
FT                   /translation="MSSVTAGSINPEKTAFSVILAVSFCHMLNDIMQSLLTALYPLLKA
FT                   NYALDFVQIGLLTFTFQVTASMLQPAVGIVTDRWALPYTLPVAMLSTCSGLLLLAHADH
FT                   FWMLLIAASLIGVGSAIFHPESSRVARLASGGRHGLAQSLFQVGGNAGSALGPLLAAFI
FT                   VLPFGQGSLGWFSIVAITGFFVLSWVSTWYVRHRRSTMSRAAPNRALPLPKARVLWTVA
FT                   ILVLLTATKNVYLASVSSYFTFFVIEKFGTSVQQAQLMLFLFLGSAAAGTFLGGPIGDR
FT                   YGARFVIWLSILGVIPFALMLPYANLFWTGVLSVVIGLVFSSAFSAIVVFAQELVPGRV
FT                   GLIAGVFFGFAFGFGGMGAAVLGVFADSHGIEFVYQICSYLPLLGIFTVFLPKIPSR"
     MSSVTAGSIN PEKTAFSVIL AVSFCHMLND IMQSLLTALY PLLKANYALD FVQIGLLTFT        60
     FQVTASMLQP AVGIVTDRWA LPYTLPVAML STCSGLLLLA HADHFWMLLI AASLIGVGSA       120
     IFHPESSRVA RLASGGRHGL AQSLFQVGGN AGSALGPLLA AFIVLPFGQG SLGWFSIVAI       180
     TGFFVLSWVS TWYVRHRRST MSRAAPNRAL PLPKARVLWT VAILVLLTAT KNVYLASVSS       240
     YFTFFVIEKF GTSVQQAQLM LFLFLGSAAA GTFLGGPIGD RYGARFVIWL SILGVIPFAL       300
     MLPYANLFWT GVLSVVIGLV FSSAFSAIVV FAQELVPGRV GLIAGVFFGF AFGFGGMGAA       360
     VLGVFADSHG IEFVYQICSY LPLLGIFTVF LPKIPSR                                397
//

If you have problems or comments...

PBIL Back to PBIL home page