(data stored in ACNUC7421 zone)

EMBL: CP001389.PE472

CP001389.PE472       Location/Qualifiers
FT   CDS             complement(532034..532600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24276"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE8"
FT                   /protein_id="ACP24276.1"
FT                   /translation="MRNTLSQPAWVGNTLRLDPKRFPQQATYVLRGDVGNVSISLDQRG
FT                   AVLRKVLPSSGLPLSIALPARAFKGVAARAIDHGDGEVTVTLELHHDDPDLCIPLLVAH
FT                   DLSDIAADWRAWAEAYRIPMLMVEADGVARPLEEHLGEIRTAPVKPRRRHSFFAERRPR
FT                   FLVRRSTGKLGVHMKIDGREIIARS"
     MRNTLSQPAW VGNTLRLDPK RFPQQATYVL RGDVGNVSIS LDQRGAVLRK VLPSSGLPLS        60
     IALPARAFKG VAARAIDHGD GEVTVTLELH HDDPDLCIPL LVAHDLSDIA ADWRAWAEAY       120
     RIPMLMVEAD GVARPLEEHL GEIRTAPVKP RRRHSFFAER RPRFLVRRST GKLGVHMKID       180
     GREIIARS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page