(data stored in ACNUC7421 zone)

EMBL: CP001389.PE473

CP001389.PE473       Location/Qualifiers
FT   CDS             532929..535238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04810"
FT                   /product="putative flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24277"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE9"
FT                   /protein_id="ACP24277.1"
FT                   /translation="MVSTYLDYNLIARDMKVSLKRVSEQTVVARDTQYYKENIGNVSSV
FT                   DAFLDDYRLYSYAMTAFGLGDMIDSVAFMRKVLESDLSDTSSFANSLTDDRYREFALAY
FT                   SFSGATAVSQTEAQLDEIIGLYDTSILNIAETQEEETRYYNVMIDKITSVDQLLNNDRL
FT                   RAYVFTAFGVDESTYSRQTIRSVLSSSSGDASSYENTVIAPKLSELETAKAAAEAQLTA
FT                   GGLTDEEEAELESKITTYANSIATLNNYIDLAAAFDFNSDGTVTAGAAQTDENKETTNE
FT                   LYISSNSRVTSQAALLNKAYFEETIASITTVTELLADTRLYNYIRTAFDLDEVTIVSAT
FT                   IKNILTSDPDDPDSYVNTIGGGDANYLALANAFNFQEDGTLAVGDSAQTAAQTTLTSNR
FT                   YMTRYNDKDDEADEKAVSAYKTAVASMTSVDDFIGSASIYDFALKAVGLDPDTASTRTI
FT                   KRVLTSDLTDPKSYVYSLKDERYVTLAKLFNFTTEGEIGPPALAQSETQIQETAKNHIV
FT                   IKSRFGSEDDKTKAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPEGVTADV
FT                   LRQIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGLYETLD
FT                   QYLRQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPDEFST
FT                   MDIDQQAKIVEKNLDLEKLSDPAELKKLLARFAVLYDLENNTEVDPAVSVLTSTGSSVG
FT                   ISADTLYTLSQLRMGG"
     MVSTYLDYNL IARDMKVSLK RVSEQTVVAR DTQYYKENIG NVSSVDAFLD DYRLYSYAMT        60
     AFGLGDMIDS VAFMRKVLES DLSDTSSFAN SLTDDRYREF ALAYSFSGAT AVSQTEAQLD       120
     EIIGLYDTSI LNIAETQEEE TRYYNVMIDK ITSVDQLLNN DRLRAYVFTA FGVDESTYSR       180
     QTIRSVLSSS SGDASSYENT VIAPKLSELE TAKAAAEAQL TAGGLTDEEE AELESKITTY       240
     ANSIATLNNY IDLAAAFDFN SDGTVTAGAA QTDENKETTN ELYISSNSRV TSQAALLNKA       300
     YFEETIASIT TVTELLADTR LYNYIRTAFD LDEVTIVSAT IKNILTSDPD DPDSYVNTIG       360
     GGDANYLALA NAFNFQEDGT LAVGDSAQTA AQTTLTSNRY MTRYNDKDDE ADEKAVSAYK       420
     TAVASMTSVD DFIGSASIYD FALKAVGLDP DTASTRTIKR VLTSDLTDPK SYVYSLKDER       480
     YVTLAKLFNF TTEGEIGPPA LAQSETQIQE TAKNHIVIKS RFGSEDDKTK AQEESEYYTA       540
     GVAKLSSLDE FLADDRLVTI ALEANGIDPE GVTADVLRQI FNSDLDDPES VINEQENSAA       600
     YVSLVTSFNF DSEGNVLRED RDSIVTRQGL YETLDQYLRQ TLEEQAGESN EGVRLALYFE       660
     RKAGSLVDAY DLLADDALAE VFRTIFSLPD EFSTMDIDQQ AKIVEKNLDL EKLSDPAELK       720
     KLLARFAVLY DLENNTEVDP AVSVLTSTGS SVGISADTLY TLSQLRMGG                   769
//

If you have problems or comments...

PBIL Back to PBIL home page