(data stored in ACNUC7421 zone)

EMBL: CP001389.PE475

CP001389.PE475       Location/Qualifiers
FT   CDS             complement(536824..537798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04830"
FT                   /product="Sua5 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24279"
FT                   /db_xref="GOA:C3MHF1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF1"
FT                   /protein_id="ACP24279.1"
FT                   /translation="MAEIIDTRIEPDRAIEKACAALSEGEPVAIPTETVYGLAADATNA
FT                   DAISRIYEMKGRPRFNPLICHVSDMAMAEAHVVFDPLSRRLAEAFWPGPLTLILPERRE
FT                   STVHALASAGLETLGIRMPEGFSRRVISHFGRPLAAPSANTSGKISPTSAAHVEADLGA
FT                   KLGLILDAGPAEIGLESTIIKVEAGRLRLLRPGGLDAAEIEALTGLTVGRPEAAGATIE
FT                   APGMLASHYAPGAAVRLNAKDVRKGEALIRFGGKALPGESAAAIVLDLSPSGNLREAAA
FT                   NLFDYMKRADASGVSSIAFGPVPSEGLGEAIVDRLERAAAPRI"
     MAEIIDTRIE PDRAIEKACA ALSEGEPVAI PTETVYGLAA DATNADAISR IYEMKGRPRF        60
     NPLICHVSDM AMAEAHVVFD PLSRRLAEAF WPGPLTLILP ERRESTVHAL ASAGLETLGI       120
     RMPEGFSRRV ISHFGRPLAA PSANTSGKIS PTSAAHVEAD LGAKLGLILD AGPAEIGLES       180
     TIIKVEAGRL RLLRPGGLDA AEIEALTGLT VGRPEAAGAT IEAPGMLASH YAPGAAVRLN       240
     AKDVRKGEAL IRFGGKALPG ESAAAIVLDL SPSGNLREAA ANLFDYMKRA DASGVSSIAF       300
     GPVPSEGLGE AIVDRLERAA APRI                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page