(data stored in ACNUC7421 zone)

EMBL: CP001389.PE476

CP001389.PE476       Location/Qualifiers
FT   CDS             complement(537867..538466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24280"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF2"
FT                   /protein_id="ACP24280.1"
FT                   /translation="MAKLRYYDASGGTQAPTPKTAGHTEFLRTGRIDRRRPWLPEQRRY
FT                   MTHEEVAEKTGRKLQAAGETTHKRINGFHASIQFPKLIFHRTLADSPHLGYCHVTAART
FT                   NLNHSREIAWAFYFANFFSDLGDETHFFERIQPSYSRMYFAVAIEPNAEGGQMAINRNV
FT                   RGNGLIFRTQDPKVALKNVLMLGARDEALRRIIRRL"
     MAKLRYYDAS GGTQAPTPKT AGHTEFLRTG RIDRRRPWLP EQRRYMTHEE VAEKTGRKLQ        60
     AAGETTHKRI NGFHASIQFP KLIFHRTLAD SPHLGYCHVT AARTNLNHSR EIAWAFYFAN       120
     FFSDLGDETH FFERIQPSYS RMYFAVAIEP NAEGGQMAIN RNVRGNGLIF RTQDPKVALK       180
     NVLMLGARDE ALRRIIRRL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page