(data stored in ACNUC7421 zone)

EMBL: CP001389.PE477

CP001389.PE477       Location/Qualifiers
FT   CDS             538526..538774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24281"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF3"
FT                   /protein_id="ACP24281.1"
FT                   /translation="MVNRLFRRFAGCLALLCVAKRPAVFAAETALLRKFSVWKRSTYRI
FT                   VYSIKYYRCLDVIARKSLSSFQNGMSHIGSCRAELPA"
     MVNRLFRRFA GCLALLCVAK RPAVFAAETA LLRKFSVWKR STYRIVYSIK YYRCLDVIAR        60
     KSLSSFQNGM SHIGSCRAEL PA                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page