(data stored in ACNUC7421 zone)

EMBL: CP001389.PE478

CP001389.PE478       Location/Qualifiers
FT   CDS             538986..540236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04860"
FT                   /product="putative dioxygenase, alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24282"
FT                   /db_xref="GOA:C3MHF4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF4"
FT                   /protein_id="ACP24282.1"
FT                   /translation="MGMDIQNDMLRKLKTRRDGYSLDRAFYIDPDYYRQDLEHIWYKDW
FT                   LFVGHDCEIPRPGNYFTLQVGDYPVVIVRDRQGAVRALHNSCRHRGSRVCTQHKGSSAK
FT                   LVCPYHQWTYELDGRLLFARQMPEGFDPSEHSLKPVNCETVGGYIFVSLADEPMDFQPF
FT                   RETVAGYLAPHRLGETKVAYESKIVEKGNWKLVWENNRECYHCAANHPELCRTYPEAPT
FT                   VTGVQGAMDDPEIGAHWERCEAAGLPSAFKIGPTGQFRMTRMPLINGAESYTMSGERAV
FT                   RQQLSAGVDANRIGTLLLFHYPTTWNHILGDHAITFRVLPLGPELTEVTTKWLVNKDAV
FT                   EGVDYTLEDLTHVWTETNDQDRQIVEENAFGIRSPAYQPGPYSAEHEGGVMQFVDWYSR
FT                   FMLDRLQGSAAPLSRVA"
     MGMDIQNDML RKLKTRRDGY SLDRAFYIDP DYYRQDLEHI WYKDWLFVGH DCEIPRPGNY        60
     FTLQVGDYPV VIVRDRQGAV RALHNSCRHR GSRVCTQHKG SSAKLVCPYH QWTYELDGRL       120
     LFARQMPEGF DPSEHSLKPV NCETVGGYIF VSLADEPMDF QPFRETVAGY LAPHRLGETK       180
     VAYESKIVEK GNWKLVWENN RECYHCAANH PELCRTYPEA PTVTGVQGAM DDPEIGAHWE       240
     RCEAAGLPSA FKIGPTGQFR MTRMPLINGA ESYTMSGERA VRQQLSAGVD ANRIGTLLLF       300
     HYPTTWNHIL GDHAITFRVL PLGPELTEVT TKWLVNKDAV EGVDYTLEDL THVWTETNDQ       360
     DRQIVEENAF GIRSPAYQPG PYSAEHEGGV MQFVDWYSRF MLDRLQGSAA PLSRVA           416
//

If you have problems or comments...

PBIL Back to PBIL home page