(data stored in ACNUC7421 zone)

EMBL: CP001389.PE479

CP001389.PE479       Location/Qualifiers
FT   CDS             539981..541333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04870"
FT                   /product="putative dioxygenase reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24283"
FT                   /db_xref="GOA:C3MHF5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF5"
FT                   /protein_id="ACP24283.1"
FT                   /translation="MACQQGCGRGCRLYARGSDACLDRDQRPGPPDRRGKRIRHPFAGL
FT                   SAGALFGGTRGGRHAVRRLVFALHAGSPAGQRRSSVAGGMTMEMARSFHHFDELHPWID
FT                   RQHLLECTSVVAETADVMTFTFRSDRPAWFRYLPGQFVTLELPTGEEPVMRTYTLSSTP
FT                   SRPLSVAVTVKAQSNSIGTRWMFDNLKPGMVLKALGPLGDFSFVRHPGEKYLFISAGSG
FT                   ITPMMSMTRWMADCAPATDVTFVSCARQPEDLLFKSELEILARQMPHLNLGFLVEGHEA
FT                   RHGWHGLRGRIDATKLPLLAPDVLERTVFCCGPEPFMRGVRDMLKGAGFDMARYHQESF
FT                   QPAAAPAAEELAIRAGPATGAGAEAARVTFTMSGKDVSAVPGQTILQTARANGVRIGAA
FT                   CEGGICGTCRVLKIAGDVAMNHNGGILDDEIDEGYILACCSRPLGDVQIEA"
     MACQQGCGRG CRLYARGSDA CLDRDQRPGP PDRRGKRIRH PFAGLSAGAL FGGTRGGRHA        60
     VRRLVFALHA GSPAGQRRSS VAGGMTMEMA RSFHHFDELH PWIDRQHLLE CTSVVAETAD       120
     VMTFTFRSDR PAWFRYLPGQ FVTLELPTGE EPVMRTYTLS STPSRPLSVA VTVKAQSNSI       180
     GTRWMFDNLK PGMVLKALGP LGDFSFVRHP GEKYLFISAG SGITPMMSMT RWMADCAPAT       240
     DVTFVSCARQ PEDLLFKSEL EILARQMPHL NLGFLVEGHE ARHGWHGLRG RIDATKLPLL       300
     APDVLERTVF CCGPEPFMRG VRDMLKGAGF DMARYHQESF QPAAAPAAEE LAIRAGPATG       360
     AGAEAARVTF TMSGKDVSAV PGQTILQTAR ANGVRIGAAC EGGICGTCRV LKIAGDVAMN       420
     HNGGILDDEI DEGYILACCS RPLGDVQIEA                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page