(data stored in ACNUC7421 zone)

EMBL: CP001389.PE480

CP001389.PE480       Location/Qualifiers
FT   CDS             complement(541373..542398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04880"
FT                   /product="glycoside hydrolase family 25 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24284"
FT                   /db_xref="GOA:C3MHF6"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF6"
FT                   /protein_id="ACP24284.1"
FT                   /translation="MRLAALVGLTFAAANARAADVEPWKARQNAIIVDAYELNSIDWDA
FT                   MLKDKRIAGFIAKASDGLPESFTCTGDHGGDTVAHCKTMWRKYAVSRELYQTRRMIARF
FT                   QGLLWGAYHLARPGNPVDQANHFLDYAEPRDDELMVLDIEGIDPEDYMSLEDAAIFAGH
FT                   IKARTGRYPILYTNHITAKYIAANRHQHRLLSRLPLWYARYKPDIRDVFPMGNWDGYAL
FT                   WQFSSSHNCGKKRCPYRVPGTLNDIDVNVAAMSVSELKKVWAQGALLPEKPPIVTVVAS
FT                   AKLGSAPAASAAVSIPLTQPLLISRAEADSGSGTGVDGTVTGAISVKAAEVHLPNQPER
FT                   R"
     MRLAALVGLT FAAANARAAD VEPWKARQNA IIVDAYELNS IDWDAMLKDK RIAGFIAKAS        60
     DGLPESFTCT GDHGGDTVAH CKTMWRKYAV SRELYQTRRM IARFQGLLWG AYHLARPGNP       120
     VDQANHFLDY AEPRDDELMV LDIEGIDPED YMSLEDAAIF AGHIKARTGR YPILYTNHIT       180
     AKYIAANRHQ HRLLSRLPLW YARYKPDIRD VFPMGNWDGY ALWQFSSSHN CGKKRCPYRV       240
     PGTLNDIDVN VAAMSVSELK KVWAQGALLP EKPPIVTVVA SAKLGSAPAA SAAVSIPLTQ       300
     PLLISRAEAD SGSGTGVDGT VTGAISVKAA EVHLPNQPER R                           341
//

If you have problems or comments...

PBIL Back to PBIL home page