(data stored in ACNUC7421 zone)

EMBL: CP001389.PE481

CP001389.PE481       Location/Qualifiers
FT   CDS             complement(542597..543586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04890"
FT                   /product="putative cationic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24285"
FT                   /db_xref="GOA:C3MHF7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF7"
FT                   /protein_id="ACP24285.1"
FT                   /translation="MNLISPEIPGLVWAYRFLPGESRCVPLATDSPVDSLQTGDGWIWL
FT                   HLALSDARTPALIERIGNLPPAAIATLTSHDTQAAITVAEDVVYGTLVDFERTFDTMTK
FT                   TIGWLHFAVSDRMIITTRLHPLRSIDRVKAAVEKSAKCGRPIDLFEMLVVEFQRTLITL
FT                   VLELTEELNVIEDRVYGEAGHRQQPGLAPLRRTVVRLHRHLRTILALLRRAGASDEDEV
FT                   PPGFIDAAERLSDRLETVDRDVFALQERARLLHEEIDSKISSETNRHLYILSLMTAFLL
FT                   PPTLVTGFFGMNTGALPFADGSGTFFAGLIIAASMGLAWLILKRVGIL"
     MNLISPEIPG LVWAYRFLPG ESRCVPLATD SPVDSLQTGD GWIWLHLALS DARTPALIER        60
     IGNLPPAAIA TLTSHDTQAA ITVAEDVVYG TLVDFERTFD TMTKTIGWLH FAVSDRMIIT       120
     TRLHPLRSID RVKAAVEKSA KCGRPIDLFE MLVVEFQRTL ITLVLELTEE LNVIEDRVYG       180
     EAGHRQQPGL APLRRTVVRL HRHLRTILAL LRRAGASDED EVPPGFIDAA ERLSDRLETV       240
     DRDVFALQER ARLLHEEIDS KISSETNRHL YILSLMTAFL LPPTLVTGFF GMNTGALPFA       300
     DGSGTFFAGL IIAASMGLAW LILKRVGIL                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page