(data stored in ACNUC7421 zone)

EMBL: CP001389.PE482

CP001389.PE482       Location/Qualifiers
FT   CDS             543873..545654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04900"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24286"
FT                   /db_xref="GOA:C3MHF8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF8"
FT                   /protein_id="ACP24286.1"
FT                   /translation="MYKAPVDEIAFTLKHVAGMAEAVRAGTFGELGEDLVEAILSEAGR
FT                   FATEEVAPLGEVGDRQGSRLVDGAVKTPEGWRDLYHDWIQGGWNGLTAPEAFGGQDLPH
FT                   MLHVAAMEMWNSGSMAFALGPTLTMGAIEAVEKHGSDALKATFLSKMVSGEWMGTMNLT
FT                   EPHAGSDLGVLKTRAERRADGTYRIFGQKIFITWGEHDFTDNIVHLVLARLPDAPAGTK
FT                   GISLFLVPKFLVNADGSLGARNDLFCHSLEHKLGIHGSPTCTMIYGDGRFGDEKGAIGY
FT                   LVGEENRGLACMFTMMNNARLAVGMQGVAIAEAATQKAIAYARERTQGRAPGWTGQGMS
FT                   PIIEHPDIARTLLTMKALTQGARAIAYACAHAVDMAHASHSEKAHQWQERSSLLTPIAK
FT                   SFATDAGVDVASMGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLR
FT                   LSEGAQVRGFIGELREVAHAVAASNRQGFGETAARLEASIADLADATEWLLAALAEGRT
FT                   AEALAGATAYQRLFGLALTGVYLAKGGLAEAGDGKQEARIALCRFAAENLLAETAALRD
FT                   RVVAGADSLAAARAILD"
     MYKAPVDEIA FTLKHVAGMA EAVRAGTFGE LGEDLVEAIL SEAGRFATEE VAPLGEVGDR        60
     QGSRLVDGAV KTPEGWRDLY HDWIQGGWNG LTAPEAFGGQ DLPHMLHVAA MEMWNSGSMA       120
     FALGPTLTMG AIEAVEKHGS DALKATFLSK MVSGEWMGTM NLTEPHAGSD LGVLKTRAER       180
     RADGTYRIFG QKIFITWGEH DFTDNIVHLV LARLPDAPAG TKGISLFLVP KFLVNADGSL       240
     GARNDLFCHS LEHKLGIHGS PTCTMIYGDG RFGDEKGAIG YLVGEENRGL ACMFTMMNNA       300
     RLAVGMQGVA IAEAATQKAI AYARERTQGR APGWTGQGMS PIIEHPDIAR TLLTMKALTQ       360
     GARAIAYACA HAVDMAHASH SEKAHQWQER SSLLTPIAKS FATDAGVDVA SMGIQVHGGM       420
     GFIEETGAAR YLRDARIAPI YEGTNGIQAI DLVTRKLRLS EGAQVRGFIG ELREVAHAVA       480
     ASNRQGFGET AARLEASIAD LADATEWLLA ALAEGRTAEA LAGATAYQRL FGLALTGVYL       540
     AKGGLAEAGD GKQEARIALC RFAAENLLAE TAALRDRVVA GADSLAAARA ILD              593
//

If you have problems or comments...

PBIL Back to PBIL home page