(data stored in ACNUC7421 zone)

EMBL: CP001389.PE484

CP001389.PE484       Location/Qualifiers
FT   CDS             546793..548892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04920"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24288"
FT                   /db_xref="GOA:C3MHG0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG0"
FT                   /protein_id="ACP24288.1"
FT                   /translation="MSKRSNLMTRILVAASCVVVGAFAGFSVYIDTLQRGTTTKAVEEN
FT                   IASSGKQAAESVANWLNGRVTLTAMAADAAARASDEAAILAALKNDVLTGEFMSTYVGN
FT                   GSGKFITWPEMKLPEGYDPRQRPWYQQAVKTDARVLTEPYIDASSGDLIISAAMPVKRE
FT                   GKLYGVAASDFSLKTLVSMITDIDVGGEGFAFLASKDGQILVHPDAKLVTKTLSDAFPV
FT                   DTPSIGSGIMHTELGGKPMLVSFVPVQGLPSVEWYIGFALDADAAYSAISQFRIAATVA
FT                   TLLAVGAMIVFLATLLSRLVIRPVTQMTGAMEKLAAGNLDVAIPGEERRDQIGSMAAAV
FT                   AVFRANALERARLEDEAHANRSLSERERLEREAQKARDVAEVQHAVEALATGLGRLADG
FT                   DLAYRIENPFADRLDRLRADFNNSVAKLHDALRAVGANARAIDAGASEIRSAADDLARR
FT                   TEQQAASVEETAAALEEITTTVKDSAHRAEEVGGLVARTRAGAEKSGEVVQNAVEAMQA
FT                   IEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAN
FT                   AAKEIKALITTSGDQVRSGVALVGETGRALQAIVAEVQEINKHVSAIVTATREQSTGLQ
FT                   EINTAVNTMDQGTQQNAAMVEEQTAASHGLAQEAAALNALLAQFKLGDGQASASFVAGQ
FT                   RRYAA"
     MSKRSNLMTR ILVAASCVVV GAFAGFSVYI DTLQRGTTTK AVEENIASSG KQAAESVANW        60
     LNGRVTLTAM AADAAARASD EAAILAALKN DVLTGEFMST YVGNGSGKFI TWPEMKLPEG       120
     YDPRQRPWYQ QAVKTDARVL TEPYIDASSG DLIISAAMPV KREGKLYGVA ASDFSLKTLV       180
     SMITDIDVGG EGFAFLASKD GQILVHPDAK LVTKTLSDAF PVDTPSIGSG IMHTELGGKP       240
     MLVSFVPVQG LPSVEWYIGF ALDADAAYSA ISQFRIAATV ATLLAVGAMI VFLATLLSRL       300
     VIRPVTQMTG AMEKLAAGNL DVAIPGEERR DQIGSMAAAV AVFRANALER ARLEDEAHAN       360
     RSLSERERLE REAQKARDVA EVQHAVEALA TGLGRLADGD LAYRIENPFA DRLDRLRADF       420
     NNSVAKLHDA LRAVGANARA IDAGASEIRS AADDLARRTE QQAASVEETA AALEEITTTV       480
     KDSAHRAEEV GGLVARTRAG AEKSGEVVQN AVEAMQAIEK SSGEISNIIG VIDDIAFQTN       540
     LLALNAGVEA ARAGEAGKGF AVVAQEVREL AQRSANAAKE IKALITTSGD QVRSGVALVG       600
     ETGRALQAIV AEVQEINKHV SAIVTATREQ STGLQEINTA VNTMDQGTQQ NAAMVEEQTA       660
     ASHGLAQEAA ALNALLAQFK LGDGQASASF VAGQRRYAA                              699
//

If you have problems or comments...

PBIL Back to PBIL home page