(data stored in ACNUC7421 zone)

EMBL: CP001389.PE486

CP001389.PE486       Location/Qualifiers
FT   CDS             complement(550182..550937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04940"
FT                   /product="hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24290"
FT                   /db_xref="GOA:C3MHG2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG2"
FT                   /protein_id="ACP24290.1"
FT                   /translation="MSDNKHSTIRLDQLLLNKGLVASRARARDAIQRGTVMVDGRTVTK
FT                   PATAFAANATITIDDPAQDYVSRAALKLVGALDHFGFDPAGQICLDIGASTGGFTEVLL
FT                   KRGAAHVVAVDVGHGQMHPRIAEDPGVTNIEGLNARAMTADDIGNRTITFIVSDVSFIS
FT                   LKLALPPALSLAGPGARCILLVKPQFEAGRDAISKAGLLKDPESAPTVAAELERWLVED
FT                   MGWRSLGLVPSPIAGGDGNKEFLLAGLKP"
     MSDNKHSTIR LDQLLLNKGL VASRARARDA IQRGTVMVDG RTVTKPATAF AANATITIDD        60
     PAQDYVSRAA LKLVGALDHF GFDPAGQICL DIGASTGGFT EVLLKRGAAH VVAVDVGHGQ       120
     MHPRIAEDPG VTNIEGLNAR AMTADDIGNR TITFIVSDVS FISLKLALPP ALSLAGPGAR       180
     CILLVKPQFE AGRDAISKAG LLKDPESAPT VAAELERWLV EDMGWRSLGL VPSPIAGGDG       240
     NKEFLLAGLK P                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page