(data stored in ACNUC7421 zone)

EMBL: CP001389.PE488

CP001389.PE488       Location/Qualifiers
FT   CDS             complement(553261..554184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04960"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24292"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG4"
FT                   /protein_id="ACP24292.1"
FT                   /translation="MSFFPGPDPLAGDKPACDAIEHLIIPRTSDIGNLEVRRALPTARR
FT                   RLVGPFIFFDRMGPALLRAGQAIDVRPHPHIGLSTVTYLFDGEIKHRDSLGTEMVIRPG
FT                   DVNLMTAGRGIVHSERSPESQRGHERSLSGLQTWLALPDDKEEVDPVFSHTEERVLPHL
FT                   ADDGVRARVVIGRFEGAASPVSTFTDTIYVDLAIEAGRSAPFAAQWEERAIYILSGEAI
FT                   IAGDHFADNQLLVFRPGDEITITAGPAGCHVMLFGGAALGSPRHIWWNFVSSSKERIDK
FT                   AKEEWRSGRFDIVPGDEEEFIPLPAS"
     MSFFPGPDPL AGDKPACDAI EHLIIPRTSD IGNLEVRRAL PTARRRLVGP FIFFDRMGPA        60
     LLRAGQAIDV RPHPHIGLST VTYLFDGEIK HRDSLGTEMV IRPGDVNLMT AGRGIVHSER       120
     SPESQRGHER SLSGLQTWLA LPDDKEEVDP VFSHTEERVL PHLADDGVRA RVVIGRFEGA       180
     ASPVSTFTDT IYVDLAIEAG RSAPFAAQWE ERAIYILSGE AIIAGDHFAD NQLLVFRPGD       240
     EITITAGPAG CHVMLFGGAA LGSPRHIWWN FVSSSKERID KAKEEWRSGR FDIVPGDEEE       300
     FIPLPAS                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page