(data stored in ACNUC7421 zone)

EMBL: CP001389.PE489

CP001389.PE489       Location/Qualifiers
FT   CDS             complement(554367..555746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04970"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13j"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24293"
FT                   /db_xref="GOA:C3MHG5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG5"
FT                   /protein_id="ACP24293.1"
FT                   /translation="MPRRIGRDRCPVGSPRRSCIRFRAPVQGSAKIAVARRLGRGEGMT
FT                   DQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAELAAWLTATSGATEAGQI
FT                   QVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAKDDSRDAEVMASALRTD
FT                   RRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLWRYFPALLELENDLGAE
FT                   WLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAVLRTPPVKVAAGTTEAA
FT                   SAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQRKQHDVEILASLPGVGR
FT                   IVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIRRQACHDRLANAMYHWA
FT                   RVAIQHDSRSRLKYAALRSQGHSHGRALRSVADRFVNVACAMLKTGTTFNPSLAEQKLS
FT                   C"
     MPRRIGRDRC PVGSPRRSCI RFRAPVQGSA KIAVARRLGR GEGMTDQKQF YAGVDWASES        60
     HHVFLTDGDG RKIGERVFRH GGEGLAELAA WLTATSGATE AGQIQVAIEV PHGPVVETLI       120
     ERGCQVHAIN PKQMDRFRDR FTLAGAKDDS RDAEVMASAL RTDRRCFRLL AAADPVVIEL       180
     REWSRMAEDL GAERNRLTNR MREQLWRYFP ALLELENDLG AEWLLDLWEA VPTPAKAARI       240
     RAATIAKLLK RNRIRRVDAT HVLAVLRTPP VKVAAGTTEA ASAHIATLIA RIRLVNRQLK       300
     QAHQRLDTLT ARLVPTEATE PGQRKQHDVE ILASLPGVGR IVLATLLAEA FDALQRRDHA       360
     ALRSLTGVAP VTKRSGKSCI VIRRQACHDR LANAMYHWAR VAIQHDSRSR LKYAALRSQG       420
     HSHGRALRSV ADRFVNVACA MLKTGTTFNP SLAEQKLSC                              459
//

If you have problems or comments...

PBIL Back to PBIL home page