(data stored in ACNUC7421 zone)

EMBL: CP001389.PE493

CP001389.PE493       Location/Qualifiers
FT   CDS             558259..558660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24297"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG9"
FT                   /protein_id="ACP24297.1"
FT                   /translation="MDGTERENVTEIRIPFRDIDMHGHMHNAAYYAHAEAALASLWRHR
FT                   PPVNNEPAYLVRRSACLFHRGLRFDEPARFTVSVAKIGGSSVSFAVRVEAGAHLAAEVE
FT                   IVWVAVDPARHQPVALPAATRDWLSAYIA"
     MDGTERENVT EIRIPFRDID MHGHMHNAAY YAHAEAALAS LWRHRPPVNN EPAYLVRRSA        60
     CLFHRGLRFD EPARFTVSVA KIGGSSVSFA VRVEAGAHLA AEVEIVWVAV DPARHQPVAL       120
     PAATRDWLSA YIA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page