(data stored in ACNUC7421 zone)

EMBL: CP001389.PE495

CP001389.PE495       Location/Qualifiers
FT   CDS             complement(559825..561321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05030"
FT                   /product="putative long-chain-fatty-acid--CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24299"
FT                   /db_xref="GOA:C3MHH1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH1"
FT                   /protein_id="ACP24299.1"
FT                   /translation="MPLARAILRHEGERLHAPAFRIEGRVFTFAELAAAAGRILHAIEQ
FT                   AALQTTEQSVLAGRVRLIALETGNHPLFAAAFIAATSGGNCAALIDPHLPESRRQRMKE
FT                   KLRPEIVIRADGDRLHLDVPSVGETHALETFDGSSPISIGEDAEPFLVVFTSGTTGEPK
FT                   AIIRDRGSWRLSLETGQHFFGIGPEATTYAPGPLAHGLALYALVECLAAGAEFIGARHF
FT                   EPRQALDVISDTRAKRLVLVPTMLRRLCEQTKSAAVTSVEKITVAGAKLTPADRSAAAR
FT                   AFPAAEVIEYYGASELGFITVAGADDDHSPTAVGKPFPGVRLAILDDRGNSLPSGETGA
FT                   IFVDSALISYGYIASNDGIGFHREGRLATVGDLGFLDRDGTLHLIGRAGGMVLSGGNNI
FT                   YPSEVEAAIMAAAGVRSVLVFGIDHPDLGSELVAVIQPNHDRFEREELERHLADALPRY
FT                   KHPRKVWLCREMPMTVSGKIAVGKLQQWIAEENGALERLF"
     MPLARAILRH EGERLHAPAF RIEGRVFTFA ELAAAAGRIL HAIEQAALQT TEQSVLAGRV        60
     RLIALETGNH PLFAAAFIAA TSGGNCAALI DPHLPESRRQ RMKEKLRPEI VIRADGDRLH       120
     LDVPSVGETH ALETFDGSSP ISIGEDAEPF LVVFTSGTTG EPKAIIRDRG SWRLSLETGQ       180
     HFFGIGPEAT TYAPGPLAHG LALYALVECL AAGAEFIGAR HFEPRQALDV ISDTRAKRLV       240
     LVPTMLRRLC EQTKSAAVTS VEKITVAGAK LTPADRSAAA RAFPAAEVIE YYGASELGFI       300
     TVAGADDDHS PTAVGKPFPG VRLAILDDRG NSLPSGETGA IFVDSALISY GYIASNDGIG       360
     FHREGRLATV GDLGFLDRDG TLHLIGRAGG MVLSGGNNIY PSEVEAAIMA AAGVRSVLVF       420
     GIDHPDLGSE LVAVIQPNHD RFEREELERH LADALPRYKH PRKVWLCREM PMTVSGKIAV       480
     GKLQQWIAEE NGALERLF                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page