(data stored in ACNUC7421 zone)

EMBL: CP001389.PE499

CP001389.PE499       Location/Qualifiers
FT   CDS             563333..564532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24303"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH5"
FT                   /protein_id="ACP24303.1"
FT                   /translation="MTIRLSNRDARRIFLAKQGLSAAPHRALGKDGLLRLIHDIGFVQV
FT                   DSISTVARAHHQILFSRNQTYRREHLSELLEEDGDLFEHWTHDASIIPSAFFVYWKHRF
FT                   KWESETLRERWRRWRGEGFDASCDETYERIASGGAVMARELKEDHHESGGWWNWHPSKT
FT                   ALEVLWRQGRLAIARRVNFQKVYDLTERVIPAHHYEGDVSHPEFIDWACRSALGRLGFA
FT                   THGEIAAFWDLASPEEAKAWVAEHRDELCEILVEPANGGKPRPSYAFTGFPDNLGDVPD
FT                   PPARIRVLSPFDPLLRDRNRTERLFGFFYRIEVFVPEAKREYGYYVFPLLEGDRLIGRI
FT                   DMKADRKRGSLEVRRLWLEEGIKPSSGRIDKVMAELDRIARFAGVGGVNLLEGWNAGLA
FT                   "
     MTIRLSNRDA RRIFLAKQGL SAAPHRALGK DGLLRLIHDI GFVQVDSIST VARAHHQILF        60
     SRNQTYRREH LSELLEEDGD LFEHWTHDAS IIPSAFFVYW KHRFKWESET LRERWRRWRG       120
     EGFDASCDET YERIASGGAV MARELKEDHH ESGGWWNWHP SKTALEVLWR QGRLAIARRV       180
     NFQKVYDLTE RVIPAHHYEG DVSHPEFIDW ACRSALGRLG FATHGEIAAF WDLASPEEAK       240
     AWVAEHRDEL CEILVEPANG GKPRPSYAFT GFPDNLGDVP DPPARIRVLS PFDPLLRDRN       300
     RTERLFGFFY RIEVFVPEAK REYGYYVFPL LEGDRLIGRI DMKADRKRGS LEVRRLWLEE       360
     GIKPSSGRID KVMAELDRIA RFAGVGGVNL LEGWNAGLA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page