(data stored in ACNUC7421 zone)

EMBL: CP001389.PE5

CP001389.PE5         Location/Qualifiers
FT   CDS             4024..4887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00050"
FT                   /product="putative glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23809"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI6"
FT                   /protein_id="ACP23809.1"
FT                   /translation="MSTNARTASVADIRAAIEDWAGALRRKDAGRVLSHGTQDCVIYSL
FT                   APPLKASDADPGGLEQWFSTWKGPLGYQLQDLEISSGGDIAFATALAHLSGEKQDGAKV
FT                   SLWYRLTLGLERTDKGWKIAHQHESVPFYMDGSFKAAIDLDPTSQVDWNAPSHPPMAGV
FT                   IAYLNVENADATAKFYGRAFGAREEDRKYAEDGKRLIHCHLTINGGALMLNDPFPEFGF
FT                   PWKPPEGFVLHLIVDDAHAWWERAVAAGAEATMPLEIAFWGDYYGQLRDPFGITWGIVA
FT                   PVKKSN"
     MSTNARTASV ADIRAAIEDW AGALRRKDAG RVLSHGTQDC VIYSLAPPLK ASDADPGGLE        60
     QWFSTWKGPL GYQLQDLEIS SGGDIAFATA LAHLSGEKQD GAKVSLWYRL TLGLERTDKG       120
     WKIAHQHESV PFYMDGSFKA AIDLDPTSQV DWNAPSHPPM AGVIAYLNVE NADATAKFYG       180
     RAFGAREEDR KYAEDGKRLI HCHLTINGGA LMLNDPFPEF GFPWKPPEGF VLHLIVDDAH       240
     AWWERAVAAG AEATMPLEIA FWGDYYGQLR DPFGITWGIV APVKKSN                     287
//

If you have problems or comments...

PBIL Back to PBIL home page