(data stored in ACNUC7421 zone)

EMBL: CP001389.PE50

CP001389.PE50        Location/Qualifiers
FT   CDS             complement(53075..53332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23854"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF17"
FT                   /protein_id="ACP23854.1"
FT                   /translation="MGLKTITSSLSKNDLAHLGAGEVGYIRKMRSEEVSRCFPEAPEMG
FT                   PGIDLWALFAADGTPILLTDNRSSTFFKAAEDDLRTVSLH"
     MGLKTITSSL SKNDLAHLGA GEVGYIRKMR SEEVSRCFPE APEMGPGIDL WALFAADGTP        60
     ILLTDNRSST FFKAAEDDLR TVSLH                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page