(data stored in ACNUC7421 zone)

EMBL: CP001389.PE500

CP001389.PE500       Location/Qualifiers
FT   CDS             564606..566021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05080"
FT                   /product="Zn-dependent protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24304"
FT                   /db_xref="GOA:C3MHH6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH6"
FT                   /protein_id="ACP24304.1"
FT                   /translation="MDTNLISLFDADEATVRKVLSETLAGADDGELFLEHAQAEVLSFD
FT                   NGRLKGGSFNTDQGFGLRAVAGEAVGYAHAGEVSLAALKRAADAVGQVTRGYSGSYAAA
FT                   PQRTNKKLYGDENPIGEPRFETKVTLLQEIDAYLRAKEPKVRQVTATVATSWQVVDILR
FT                   ADGHRVHDVRPMTRINISVVVGEGDRQESGTFGIGGRRGFGDFITEENWKRGADEALRQ
FT                   ALVNLEAVDAPAGTMDVVLASGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGEQVAAK
FT                   GVTVVDDGTIEARRGSISIDDEGTPSGYNVLIEDGKLVGYMQDRQNARLMGMQPTGNGR
FT                   RQGYAHVPMPRMTNTYMLAGDRTPEEIIASVKKGIYAVSFGGGQVDITSGKFVFGCTEA
FT                   YLIEDGKVGAPAKGAMLIGNGPDAMRRVTMVGNDMKLDTGIGNCGKGGQWVPVGVGQPH
FT                   LRMDQITVGGTQA"
     MDTNLISLFD ADEATVRKVL SETLAGADDG ELFLEHAQAE VLSFDNGRLK GGSFNTDQGF        60
     GLRAVAGEAV GYAHAGEVSL AALKRAADAV GQVTRGYSGS YAAAPQRTNK KLYGDENPIG       120
     EPRFETKVTL LQEIDAYLRA KEPKVRQVTA TVATSWQVVD ILRADGHRVH DVRPMTRINI       180
     SVVVGEGDRQ ESGTFGIGGR RGFGDFITEE NWKRGADEAL RQALVNLEAV DAPAGTMDVV       240
     LASGWPGVML HEAVGHGLEG DFNRKKTSAF AGLLGEQVAA KGVTVVDDGT IEARRGSISI       300
     DDEGTPSGYN VLIEDGKLVG YMQDRQNARL MGMQPTGNGR RQGYAHVPMP RMTNTYMLAG       360
     DRTPEEIIAS VKKGIYAVSF GGGQVDITSG KFVFGCTEAY LIEDGKVGAP AKGAMLIGNG       420
     PDAMRRVTMV GNDMKLDTGI GNCGKGGQWV PVGVGQPHLR MDQITVGGTQ A                471
//

If you have problems or comments...

PBIL Back to PBIL home page