(data stored in ACNUC7421 zone)

EMBL: CP001389.PE503

CP001389.PE503       Location/Qualifiers
FT   CDS             567218..568600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05110"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-20f"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24307"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C3M906"
FT                   /protein_id="ACP24307.1"
FT                   /translation="MQTHCIAEQLEFEGFDGHKVVAGFDGGAITSDAGALLLRHVDGVI
FT                   GLFDRVAACFVDDRDPTCTVHSVRTLVGQRVAAIALGYEDVDDHDRLRHDPVLALLSER
FT                   LTPKRQDCAVLAGKSTLNRLEHGRLGQPTRYHKIAYDRQALEALFIELFLDAHDSPPEE
FT                   IVLDLDATDDPLHGHQEGRFFHGYYNCYCYLPLYIFCGRHLLSAKLRRSNIDASAGSVA
FT                   EIDRIIGQIRQSWPNVRIILRADSGFARDELMDWCETNKVDYVFGLARNPRLERQIAPA
FT                   MEEASLLSQASAQATRVFRDFLWSTKDSWTRRRRVVGKAEWTLLGANPRFIVTSLKPER
FT                   WAAQTLYEDLYCARGDMENRIKECQLDLYADRTSAHTMHANQLRLWFASLAYVLICALR
FT                   RLGLAHTRLAEATCGTIRLKLLKIGAQVRVSVRRIKIAMASACPYADEFALAHARIRAA
FT                   AR"
     MQTHCIAEQL EFEGFDGHKV VAGFDGGAIT SDAGALLLRH VDGVIGLFDR VAACFVDDRD        60
     PTCTVHSVRT LVGQRVAAIA LGYEDVDDHD RLRHDPVLAL LSERLTPKRQ DCAVLAGKST       120
     LNRLEHGRLG QPTRYHKIAY DRQALEALFI ELFLDAHDSP PEEIVLDLDA TDDPLHGHQE       180
     GRFFHGYYNC YCYLPLYIFC GRHLLSAKLR RSNIDASAGS VAEIDRIIGQ IRQSWPNVRI       240
     ILRADSGFAR DELMDWCETN KVDYVFGLAR NPRLERQIAP AMEEASLLSQ ASAQATRVFR       300
     DFLWSTKDSW TRRRRVVGKA EWTLLGANPR FIVTSLKPER WAAQTLYEDL YCARGDMENR       360
     IKECQLDLYA DRTSAHTMHA NQLRLWFASL AYVLICALRR LGLAHTRLAE ATCGTIRLKL       420
     LKIGAQVRVS VRRIKIAMAS ACPYADEFAL AHARIRAAAR                             460
//

If you have problems or comments...

PBIL Back to PBIL home page