(data stored in ACNUC7421 zone)

EMBL: CP001389.PE507

CP001389.PE507       Location/Qualifiers
FT   CDS             572195..572647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24311"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI3"
FT                   /protein_id="ACP24311.1"
FT                   /translation="MQDIAKWIDGKKGFSFALLRSAALCLTVVALPGCMGGGLDLFGSS
FT                   SVDRSVATGTVPVAKTSDGLSDAVTVRNAVSSAEITEGGSAIPWANATSGSAGVISSIE
FT                   EDHASGVLCRRFTTTRHSFEGIAKFDGRTCRLDNGEWYLTSFGPQG"
     MQDIAKWIDG KKGFSFALLR SAALCLTVVA LPGCMGGGLD LFGSSSVDRS VATGTVPVAK        60
     TSDGLSDAVT VRNAVSSAEI TEGGSAIPWA NATSGSAGVI SSIEEDHASG VLCRRFTTTR       120
     HSFEGIAKFD GRTCRLDNGE WYLTSFGPQG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page