(data stored in ACNUC7421 zone)

EMBL: CP001389.PE511

CP001389.PE511       Location/Qualifiers
FT   CDS             complement(575702..575962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24315"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI7"
FT                   /protein_id="ACP24315.1"
FT                   /translation="MRFVIATLMATASLLSPLSVHAESADVEAVITNIDTEQLSLSLDD
FT                   GKSYQAPEEFNFEGLEAGVKVLVFYTEVDGKRVINDLEIVQ"
     MRFVIATLMA TASLLSPLSV HAESADVEAV ITNIDTEQLS LSLDDGKSYQ APEEFNFEGL        60
     EAGVKVLVFY TEVDGKRVIN DLEIVQ                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page