(data stored in ACNUC7421 zone)

EMBL: CP001389.PE518

CP001389.PE518       Location/Qualifiers
FT   CDS             583355..583495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24322"
FT                   /db_xref="GOA:C3MHJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ4"
FT                   /protein_id="ACP24322.1"
FT                   /translation="METVKLSETQKKSRRGRNIALGLVLAGLVGLFYVVTLIKFGGGMA
FT                   N"
     METVKLSETQ KKSRRGRNIA LGLVLAGLVG LFYVVTLIKF GGGMAN                       46
//

If you have problems or comments...

PBIL Back to PBIL home page